General Information

  • ID:  hor002175
  • Uniprot ID:  P01322
  • Protein name:  Insulin-1 B chain
  • Gene name:  Ins1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005158 insulin receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0008286 insulin receptor signaling pathway; GO:0010033 response to organic substance; GO:0031623 receptor internalization; GO:0034097 response to cytokine; GO:0042593 glucose homeostasis; GO:0043434 response to peptide hormone; GO:0050714 positive regulation of protein secretion; GO:0051591 response to cAMP; GO:0071333 cellular response to glucose stimulus; GO:1901701 cellular response to oxygen-containing compound
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005829 cytosol

Sequence Information

  • Sequence:  FVKQHLCGPHLVEALYLVCGERGFFYTPKS
  • Length:  30
  • Propeptide:  MALWMRFLPLLALLVLWEPKPAQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
  • Signal peptide:  MALWMRFLPLLALLVLWEPKPAQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Insr
  • Target Unid:  P15127
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01322-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002175_AF2.pdbhor002175_ESM.pdb

Physical Information

Mass: 395749 Formula: C161H240N40O40S2
Absent amino acids: DIMNW Common amino acids: L
pI: 8.23 Basic residues: 5
Polar residues: 9 Hydrophobic residues: 11
Hydrophobicity: 17.67 Boman Index: -1282
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 84.33
Instability Index: 1929.33 Extinction Coefficient cystines: 3105
Absorbance 280nm: 107.07

Literature

  • PubMed ID:  4311938
  • Title:  Proinsulin and the biosynthesis of insulin.